PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gh_D03G1463
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family MYB
Protein Properties Length: 481aa    MW: 54110.1 Da    PI: 9.0272
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gh_D03G1463genomeNAU-NBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding57.63e-1856102148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      +g WT+eEd ll+davk+   ++Wk Ia+ ++ gRt+ qc +rwqk+l
      Gh_D03G1463  56 KGGWTKEEDNLLIDAVKKCNARNWKGIAEFLP-GRTDIQCLHRWQKVL 102
                      688*****************************.************986 PP

2Myb_DNA-binding57.72.8e-18108154148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      +g+WT+eEd+ + ++vk++G ++W+ Ia+ +g gR +kqc++rw+++l
      Gh_D03G1463 108 KGPWTKEEDDCITRLVKKFGCRRWSVIAKFVG-GRIGKQCRERWYNHL 154
                      79******************************.*************97 PP

3Myb_DNA-binding40.56.2e-13160202145
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45 
                      +++W +eE+ +l  +++ +G++ W++ a+ ++ gRt   +k++w+
      Gh_D03G1463 160 KDSWGEEEEAILTYYHQIYGNK-WSKLAELLP-GRTNIAIKNHWN 202
                      679*******************.*********.***********8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466892.15E-2053116IPR009057Homeodomain-like
SMARTSM007175.0E-1655104IPR001005SANT/Myb domain
PROSITE profilePS5129416.33156102IPR017930Myb domain
PfamPF002494.6E-1656102IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.609.7E-2458118IPR009057Homeodomain-like
CDDcd001672.65E-1459102No hitNo description
PROSITE profilePS5129427.59103158IPR017930Myb domain
SuperFamilySSF466893.22E-29105201IPR009057Homeodomain-like
SMARTSM007171.1E-16107156IPR001005SANT/Myb domain
PfamPF002491.9E-17108154IPR001005SANT/Myb domain
CDDcd001675.24E-15110154No hitNo description
Gene3DG3DSA:1.10.10.606.5E-25119161IPR009057Homeodomain-like
SMARTSM007172.0E-12159207IPR001005SANT/Myb domain
PROSITE profilePS5129415.866159209IPR017930Myb domain
PfamPF002491.2E-9160202IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.2E-19162209IPR009057Homeodomain-like
CDDcd001672.47E-8162205No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 481 aa     Download sequence    Send to blast
MVEVKKEKEE YYYEDLIEED RSSASPSSFS SSSFDTITTS PSLQGRVTGP TLWSMKGGWT  60
KEEDNLLIDA VKKCNARNWK GIAEFLPGRT DIQCLHRWQK VLNPGISKGP WTKEEDDCIT  120
RLVKKFGCRR WSVIAKFVGG RIGKQCRERW YNHLDPTIRK DSWGEEEEAI LTYYHQIYGN  180
KWSKLAELLP GRTNIAIKNH WNCTLKKKLG LHSPRRYAKG IKKGSSDFHD RETMPKGMKV  240
KDLRQGLDET KFVNQNVTVD YSAETCNLDL VLGIAGPPEI KLGADPGNVG KYRSPGVSYD  300
QMPVHFNEKG TIDDSIVGSV TRYDKHTKVH EPQPALFRIV SQGGCALLAS TSVGSPSSSL  360
AFNPESKIRR TNTAYSSDCS LHNEPAQQEG SISTVFPVVE NGDIRFKSSF CHASPPNKLS  420
GSLSPNSRSL ESILRISAMT FRNTPSIIRK RSYKEGWNDN ISESAASYPV RTFSCFHMEE  480
M
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h88_C7e-62462096159MYB PROTO-ONCOGENE PROTEIN
1h89_C7e-62462096159MYB PROTO-ONCOGENE PROTEIN
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012471838.10.0PREDICTED: myb-related protein B-like
TrEMBLA0A0D2QUE30.0A0A0D2QUE3_G
STRINGSolyc08g080580.2.13e-79(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM2070356
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G02320.26e-71myb domain protein 3r-5